logo chain-hook.ru CHAIN-HOOK.RU | Личный кабинет | Контакты | Доставка товара

Платье


Нарядное платье без рукавов из ажурного гипюра. Отличный выбор для любого тожества.

Цвет: черный

Ростовка изделия 170 см.

3499 РУБ

LacyWear s-12-snn похожие

Подробнее

Платье


Однотонное платье с длинными рукавами. Модель выполнена из эластичного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета:бежевый

Ростовка изделия 170 см.

1899 РУБ

LacyWear s-135-snn похожие

Подробнее

Платье


Уютное платье с короткими рукавами из вязаного трикотажа. Вязаный трикотаж - это красота, тепло и комфорт. В вязанных вещах очень легко оставаться женственной и в то же время не замёрзнуть.

В изделии использованы цвета: черный

Рост девушки-фотомодели 173 см

1799 РУБ

LacyWear s-189-snn похожие

Подробнее

Платье


Цветное платье с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для любого случая.

В изделии использованы цвета: бордовый, бежевый

Рост девушки-фотомодели 180 см.

3199 РУБ

LacyWear s-119-snn похожие

Подробнее

Платье-туника


Мягкое и уютное платье-туника с длинными рукавами. Модель выполнена из вязаного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: карамельный

Рост девушки-фотомодели 180 см

3199 РУБ

LacyWear s-177-snn похожие

Подробнее

Платье


Теплое платье с короткими рукавами. Модель выполнена из вязанного трикотажа. Вязаный трикотаж - это красота, тепло и комфорт. В вязаных вещах очень легко оставаться женственной и в то же время не замёрзнуть.

Цвет: черный, серый

Ростовка изделия 170 см.

2140 РУБ

LacyWear s-16-snn похожие

Подробнее

Платье


Цветное платье с круглой горловиной и короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для любого случая.
Платье без пояса.

В изделии использованы цвета: розовый, бирюзовый и др.

Рост девушки-фотомодели 170 см

2799 РУБ

LacyWear s-161-snn похожие

Подробнее

Платье


Интересное платье с баской и короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для любого случая.

Цвет: белый, серый, коралловый

Ростовка изделия 170 см

3799 РУБ

LacyWear s-88-snn похожие

Подробнее

Платье


Цветной платье с круглой горловиной и рукавами 3/4. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: желтый, коралловый, белый, синий и др.

Рост девушки-фотомодели 180 см.

2799 РУБ

LacyWear s-162-snn похожие

Подробнее

Платье


Однотонное платье с короткими рукавами и рубашечным воротником. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного гардероба.

Цвет: черный

Рост девушки-фотомодели 180 см

2399 РУБ

LacyWear s-47-snn похожие

Подробнее

I Mina'Trentai Dos Na Liheslaturan Guahan Bill ... - Guam Legislature

24 июл. 2013 г. - \1ichael F.Q. Snn Nicolas. Member. Senator ... D.G,. BlJILDING IN HAGATNA, IN CONJUNCTION WITH THE GUAM PRESERVATION ... Should you have any questions, please feel free to contact our office at 472-7679.

Inna Felix — Тонкий свет

DJ Daks NN & DJ Aleksandr - Oceans Of Planet Earth (Original Mix 2018) 6 403 28 Future House. Анатолий Шигин - ...

Pfam: Arb2 - GenomeNet

... #=GF NC 26.50 26.50; #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM ... A0A166R3Z7.1 #=GS A0A0N1H429_9EURO/472-735 AC A0A0N1H429.1 #=GS ...

A collection of model stellar spectra for spectral types B to early-M ...

9 окт. 2018 г. - SNN acknowledges the support of DOE grant DE-FG52-09NA29580 .... D. G., & Lanz, T. 1994, A&A, 282, 151 [NASA ADS] [Google Scholar] ...

Archive mmCIF file

S N N 6 ? T N N 6 ? U N N 6 ? V N N 6 ? W N N 6 ? X N N 7 ? Y N N 5 ? Z N N 6 ? .... L DG 1 L CA 101 1_555 ? ..... LYS E 472 CYS E 477 E 5 LEU E 214 ?

Sheet1 - Brentwood Academy

... Column463, Column464, Column465, Column466, Column467, Column468, Column469, Column470, Column471, Column472, Column473, Column474 ...

QUERY >UniRef90_W5M242 >UniRef90_W5M242 ...

... >UniRef90_UPI0003501881 >UniRef90_U3I472 >UniRef90_U3I472 .... S SKGD PNED CCCG A AAP SA PAC G DG LPP S VE K K R P F SAAS D D A ... LLLV GANNIN SSSSVVSSSSTLLANNL SSSSSSSSIA SEEEALPP SNN VV NS ...

Proceedings of the DAE Symposium on Nuclear Physics

Determination of hexadecapole deformation for $^{160}$Gd nucleus using quasi-elastic .... Kumar,P Sandya Devi,G. N Jyothi,A Tejaswi,P. N Patil,A Chatterjee, 472, pdf ..... Search for light-by-light scattering in PbPb collisions at \SNN 5.02 TeV, ...

YouTube (Official) - Google+

Tim Clark (SNN) Owner. YouTube (Official) MINDS.COM ... #TrippleOG #Culture #Cali #SoCal #TimClarkSNN #Legend #Genius #Jedi #Ninja #Mogul #SomethingNewNow #Boss #King #DJ. minds.com. Show all 4 comments

Effects of hsp90 binding inhibitors on sGC-mediated vascular relaxation

Long-term (15 h) exposure to RA inhibited all NO donor-induced relaxations; however, GA inhibited SNN-induced relaxation only. The effects of GA and RA ...

Trees vs Neurons: Comparison between random forest and ANN for ...

15 июл. 2017 г. - The ANN model performed marginally better than the RF model. •. RF model can be ...... R.O. Duda, P.E. Hart, D.G. StorkPattern Classification. John Wiley & Sons ... 472-484, 10.1016/j.eswa.2005.04.043. ISSN 0957-4174.

Transverse-Mass Dependence of Two-Pion Correlations in Au 1 Au ...

13 мая 2002 г. - sNN φ. sNN 5 130 GeV. K. Adcox,40 S. S. Adler,3 N. N. Ajitanand,27 Y. Akiba,14 J. ... P. Chung,27 V. Cianciolo,29 B. A. Cole,8 D. G. D'Enterria,34 G. David,3 H. ..... 472. 633. Rinv. 6.74 6 0.31. 6.42 6 0.46. 3.46 6 0.46. lLCMS.

Pion Interferometry of φ φ φ sNN 5 130 GeV Au 1 Au ... - UCL Discovery

20 авг. 2001 г. - sNN φ. sNN 5 130 GeV Au 1 Au Collisions at RHIC. C. Adler,11 Z. Ahammed,23 C. Allgower,12 .... T. Ullrich,2 D. G. Underwood,1 G. Van Buren,2 A. M. VanderMolen,17 A. Vanyashin,15 I. M. Vasilevski,10 ..... 50B, 472 (1974).

LacyWear Блузка DG(29)-HVD

LacyWear Блузка DG2915(2236+472) lacy блузка dg9014 1947. LacyWear Блузка ... Цвет: розо... LacyWear Блузка DG(44)-SNN lacy блузка dg9014 1947.

Medicago: BLAST2 result

14 дек. 2001 г. - ... N +RRKLG+ +CGT NPIDDCWRCDP W NR+RLA+CAIGFG+ AIGG+DG .... H + SDGDG++I+G +H+WVDHCS SNC DGLID + GSTA+T+SNN Sbjct: 188 ... OSJNBa0095E20.8 protein [Oryza sativa] Length = 472 Score = 523 bits ...

Dg 473 snn linkhalmischle.cf

Доставка покупок из интернет магазина linkhalmischle.cf осуществляется по всей территории России и стран СНГ. Самовывоз с магазинов в Вашем ...

Dg 470 snn clubmf.ru

Женская футболка с принтом. Модель выполнена из мягкого трикотажа. Отличный выбор для любого случая. В изделии использованы цвета: белый и ...

;base64,H4sICD1opFkC/zR1MGcuY2lmANy92XLjOLOoe++nUMSKE ...

... 9JdW/4jGN/mr0V1+uKwfmm+Q4p9r/dfv+Gd+ZgyXHy74xKfIfP9R/EYf/8zPwKgcfsuIov+w9Mfa ..... VPAxg4D472UI+3PV3/bwjX3KXp8VfJ4PiB2AdH9FvN+fhT/P/PAS5k+P+ ...... +Gp+8vk+uvChnkPxmfzHG91DP+Gr+Snn/cGYf3TwBf/Z ...

Supporting Figure 6 - PNAS

D H DG. K K G DV DS Q T VE EE. I PS D R F --A PRYKPRSVI S. LNQCQ. ALP FS. TGS A. CrRelish ... Human p100 472: AGQR TA E. DmRelish 588 : WF EH---- ...

Dg 473 snn - 72-shop.ru

#николай старшинов что было то было #mini racer drone 210mm with flysky # arm033 11 bl #алексей тепляков деятельность органов #akr 550 im #an870 ...

Necessary and sufficient conditions for weak convergence of random ...

The limit distribution of the sequence {(SNn − Ln)/sn, n ≥ 1} is presented ..... 472. A. Krajka, Z. Rychlik. Corollary 3. Let {Xn, n ≥ 1} be a sequence of independent random ..... (eiyx − 1 − iyx/(1 + x2)) (1 + x2)/x dG(x)| > ε2]+2ε1 + 2ε2, n ≥ 1.

Mechanisms of tinnitus | British Medical Bulletin | Oxford Academic

1 окт. 2002 г. - ... ensemble spontaneous activity (ESA)58, and spectrum of background neural noise (SNN)59. Evidence for synchronised spontaneous neural ...

PC4 distribution RAB - Commission for Regulation of Utilities

472, Land, 40, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000, 0.000 ...

Kiwifruit Genome Database

... 506 P WKP D G RS E PVL N D + G +++ N A A D +S Sbjct: 422 ... 370 EP+RDPL LPNQ P+S S SGP SMDID DY + S CT SNN R PV E QR H Sbjct: 305 ... WKPS D+ G S Y Sbjct: 472 VDFIAELIDYLIMKLLPWWKPSPDHFSCGELSPY 505 ...

Познакомимся поближе - Агропромышленный парк Казань

... /Gn9gZ/DmvWHbd4Zu2ha8fmvIul1Rm/dG ..... Nd7b1+3etS5g5+fBymsCtoJYG7Tx07Atn0Vt/CJm03+SNn+fsWPXQU3dUnObejerWg== ...

Bioengineering | Free Full-Text | A Review on Bioconversion of Agro ...

28 окт. 2018 г. - Ann. Microbiol. 2012 .... [Google Scholar]; Vandamme, E.J.; Derycke, D.G. Microbial inulinases: Fermentation process, ..... 1883, 43, 472–486.

Кресло George DG-F-ACH473-akv-04 - vasha-komnata.ru

Интернет-магазин «Ваша комната» предлагает вам купить Кресло George DG-F-ACH473-akv-04 по цене: 72 000 руб Быстрая доставка, низкие цены. Артикул: 20610

mic21 정보 | 다이빙 숍 mic21c<

다이빙 숍 mic21은 일본에서 고품질의 스쿠버다이빙 장비와 수중사진 장비를 저렴한 가격으로 판매하고 있습니다. 9개 매장이 ...

TS Series U/M English

NAP-10-472. : COSEL CO. ...... sensor detects the origin dog, the robot moves in the direction opposite to the origin point and reads phase Z which is magnetized ...

Curriculum Vitae of - UW Faculty Web Server - University of Washington

10 мая 2007 г. - 454-472. "Isobaric Analog Spectroscopy with Polarized Protons,'' Bull. .... "Direct observation of dijets in central Au+Au collisions at √SNN ...... "Measuring DG via Direct-g Production with STAR,'' J. Balewski and The STAR.

Social Security Numerology - Learn About Your Social Security Number

SocialSecurityNumerology.com is the web's premier site for information about social security numbers and for searching a particular number.Не найдено: dgLacy 5 • Майки • Совместные покупки SuperPuperhttps://superpuper.ru/catalog_newdesign.php?catalog_id=2298760Сохраненная копияАртикул: DG(638)-SNN. Размер ... Артикул: DG(497)-SNN. Размер ... Артикул: DG(666)-SNN. Размер ... Артикул: DG(664)-SNN ... Артикул: DG(648)-SNN.

read access.txt - StockPickerUSA

Nr Company Name TKR Member of Cusip # 1: 111 Inc : YI: S: YI" 2: 1347 Ppty Insur : PIH: S: PIH" 3: 180 Degree Cap : TURN: SO: HHGP" 4: 1800Flowers.Com : FLWS

research output – january to december 2017 - iThemba LABS

(1530)0 in p–Pb collisions at √sNN = 5.02 TeV. European ... 770 (2017) 459-472. Adamova D .... Greenlees P T, Jenkins D G, Jones G A, Jones P,. Joss D T ...

Reduction of Uroporphyrinogen Decarboxylase by ... - Plant Physiology

The lower panel of Figure 3 shows the UROD protein levels in each. SNN. RNA. «• • -. #2. Protein ...... Plant Physiol 105: 467-472. Miyajima K, Hirata M, ... Diego, CA, pp 13-36. Sweeney GD (1986) Porphyria cutanea tarda, or the uroporphy-.

S47 snn. Купить вечернюю блузку в интернет-магазине Lacywear.ru в Москве

Блузка DG(64)-RNK. Блузка. 2190 руб. 2433 руб. ... Блузка DG(118)-KNA. Блузка. 2590 руб. 2878 руб. .... Блузка DG(472)-SNN. Блузка. 1840 руб. 2044 руб.

Ntgent_schouwburg - L-Acoustics

... WZd0{a f1c& R=/[g )K?B Qtl:Z {M&3-;G *+{snN vY}- a9tc jUu];e z=35 m9Dy% ..... PDSa $ 5F 'x%Ri A;ni 7R"V r`!" &v)C wJ8o8Q >d@W DG'e v6!~ ..... R&58` &c;BI S6-_ (Qn: xBRSEuy &t'V; S*S% nUVv z ]T; YDe1r 472H$ W0&m ( 11h'! >i`@ 9!

Женская водолазка DG(391)-SNN - купить в интернет-магазине ...

Женская водолазка DG(391)-SNN, материал гипюровая сетка, страна Турция , ... Полотенце именное махровое. 473. LacyWear. Полотенце пляжное.

S47 snn. DJ472 - DJ 472 Flight Tracker - FlightStats

DJ472 Flight Tracker - Track the real-time flight status of DJ 472 live using the FlightStats Global Flight Tracker. See if your flight has been delayed or cancelled ...Не найдено: snn(PDF) Rituximab in the spondyloarthropathies: Data of eight patients ...https://www.researchgate.net/.../41166043_Rituximab_in_the... - Перевести эту страницу1 авг. 2018 г. - Scott DG, Bacon PA. .... Ann Rheum Dis February 2010 Vol 69 No 2 471 ... Ann Rheum Dis 2010;69:471–472. doi:10.1136/ard.2008.107102.

Cultural Transmission of Fine-Scale Fidelity to ... - CEBC - CNRS

3 сент. 2018 г. - by Baker et al. (2013). These haplotypes overlapped on a 472 bp ... 1 whereas for 2 undifferentiated groups, Snn is near 0.5 (Hudson. 2000). Finally, we used ...... Nature. 346:705–705. Thompson JD, Higgins DG, Gibson TJ.

www.state.ky.us

Drawdown Group Codes Funding Source Codes Entitywide Project Codes Summary VEZ** VF0** VF1** VF2** VF3** VF4** VF5** VF6** VF7** VF8** VF9** VFA** VFB** VFC** VFD**

DG 2530 473 SCHUBERT wanderer*fantasie POLLINI 1974 GERMAN STEREO VINYL ...

DG Records 2530 473 GER 1974. Stereo Pressing with Fully Laminated Sleeve. | eBay!

Response - Palmetto Bay

FRONTAGE. DG MIN 20%. 223.4. 279-4" (BUILDING LENGTH). KURB. SNN ..... 472 PS. PROVIDED. 557 PS. N88° 06' 21" E 625.74' (CAL.) 625.85' (MEAS.).

The Jews of Jamaica - University of Florida Digital Collections

472-483. encouraged by a donation from Aaron Matalon, a leading member of the present Kingston ..... a7nn rns3 nonw ina3 snn. MII 1,11M 1-11121= x ..... S. B. A.G .D.G 30 Jacob Hezekiah Haim Baruh Alvares, 224. Marc 1723. Portuguese.

Купить вечернюю блузку в интернет-магазине Lacywear.ru в Москве

Блузка DG(64)-RNK. Блузка. 2190 руб. 2433 руб. ... Блузка DG(118)-KNA. Блузка. 2590 руб. 2878 руб. .... Блузка DG(472)-SNN. Блузка. 1840 руб. 2044 руб.

Supplementary Data

GD 81, WD FY ABHGA P24. MAPK 10. PTPN13. SLC1098. ... 472. 93219577 .1.209497986. 428.3.435.2. S. G. 72270852. 170226739. 22109815. 170894314.

Measurement of single electrons and implications for charm ...

13 мая 2002 г. - P. Chung,27 V. Cianciolo,29 B. A. Cole,8 D. G. D'Enterria,34 G. David,3 H. Delagrange,34 A. Denisov,12 A. .... sNN. 130 GeV at the Relativistic Heavy Ion Collider. (RHIC). ..... 472 (1976); M. Bourquin and J.-M. Gaillard, Nucl.

Mypet/gview/view_xml.cgi?id=5100

... 472 F+ D+GEGIHEG++ ++LV GD V DG + +ETDK TTEV +PV+GV+ +I +K G+ + ...... +K GD++ L +E DK +TE+ SP G+I+KI ++VGD + G I +D + K+EP + + +SNN +P ...

Motif Transition in Growth Patterns of Small to Medium‐Sized Silicon ...

22 февр. 2005 г. - We thank Prof. T. Frauenheim, Prof. K.‐M. Ho, Prof. K. A. Jackson, Prof. M. Jarrold, Prof. B. Pan, Dr. A. A. Shvartsburg, Dr. J. L. Wang, and Dr.

mtx 1105 bk bl m - Поиск товаров в интернете

Последние запросы: clarinsхлопковый кардиганatlantisdg 472 snndog adult pate and chunkies with chicken с65 деревянная 66 5х34х70смнесмываемый ...

Dg 43 snn banyaelkino.ru

Dg 43 snn banyaelkino.ru ... original women s first #мыло жидкое palmolive кухонное #x470 taichi #машинка для стрижки волос moser 1871 #кепка тракер с ...

Sheet1 - ERF Historic Vehicles Limited REVS

63. 64. 65. 66. 67. 68. 69. 70. 71. 72. 73. 74. 75. 76. 77. 78. 79. 80. 81. 82. 83. 84. 85. 86. 87. 88. 89. 90. 91. 92. 93. 94. 95. 96. 97. 98. 99. 100. 101. 102. 103 ...

INDEX TO TABLE B. NOTE – The figures denote, respectively ... - uscria

129 Bisco, Ann M. and. Emma. 430 .... 472. Doniphan, William T. 64. Forrest, Ann M. S.. 276. Hoover, John. 482. Davis, Sarah ..... guardian of G.D.. Walters. 79.

Rapid metabolic profiling of Nicotiana tabacum defence responses ...

9 июн. 2010 г. - Successful defence of tobacco plants against attack from the oomycete Phytophthora nicotianae includes a type of local programmed cell death ...

Publications - | Paul Scherrer Institut (PSI)

... Dijets in Proton-Proton and Proton-Lead Collisions at sNN=5.02TeV Sirunyan AM, Tumasyan A, ...... Nepal S, Nouri N, Pattie RW, Pérez Galván A, Phillips DG, Picker R, Pitt ML, Plaster B, Ramsey ...... PHYSICS LETTERS B 763, 472 (2016).

Showdj.be - DEDICACE DE DJ 472 L'ENFANT DE DIEU anyama au ...

DEDICACE DE DJ 472 L'ENFANT DE DIEU anyama au 10chiffres. Image may contain: 2 people. Image may contain: 3 people. Image may contain: 1 person.Не найдено: snnNCBI CDD Conserved Protein Domain Coatomer_WDADhttps://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid... - Перевести эту страницу16 нояб. 2009 г. - ... --CNAHGDGekVI-KHEKNLKALFPgp-aGYILRQTE 452 gi 122093347 .... 472 DDGLQLFDVQqKIVTASVK-VSkvRYVIWNKSmEYAALLSKHTLT ...

Strange antiparticle-to-particle ratios at mid-rapidity in √ sNN = 130 ...

R.E. Tribbleaa, V. Trofimovr, O. Tsaif, T. Ullrichb, D.G. Underwooda, G. Van Burenb, ... sNN = 130 GeV Au + Au collisions using the STAR detector. The ratios ..... B 472. (2000) 243. [18] K.H. Ackermann, et al., STAR Collaboration, Nucl. Phys.

Getting calls from 800-472-5118? (4) - 800Notes

I got a call from them saying he was from L J Ross Associates in Ann Arbor and to give them a call ... D.G. replies to Dolores .... 1-800-472-5118

Ethnicity in Women Physicians | SpringerLink

Other chapters in this book have reviewed many of the challenges faced by women physicians. Although minority women physicians face these same ...

Service/repair manuals owners/users manuals schematics

Service manuals, repair manuals, owner's manuals for Panasonic Sony JVC Samsung Sharp Pioneer Sanyo Hitachi Philips Kenwood LG Toshiba & others

CAoGD

2 февр. 2018 г. - ... 1159 +P L +LK L T + SNN FV L +S ++ Sbjct 401 ... 472 Query 1125 .... 1514 +G + +G+KL+ AN+GD A+LS+ G L+ H P + Sbjct 138 ...

STOCKHOLM 1.0 #=GF ID Glyco_hydro_30C #=GF AC PF17189.4 ...

... Bateman A;0000-0002-6982-4660 #=GF GA 22.0 22.0 #=GF NC 21.9 21.9 #=GF TC 22.0 22.0 #=GF SE IPR001139 #=GF BM hmmbuild HMM.ann SEED.ann ...

MF088985 - Texas General Land Office

7 февр. 1983 г. - I ann nt tt In H.MC nt ... lnrt Of'lu". Appltr ...... ~sf of my kn(]W,.dg• ond b1li~f ...... 472 22. 10 077. 122. 7. 1 7 1 q. 14.87. 487 09. 10 353 . 276. 9 3/4.

THE HIGH COURT OF ORISSA : CUTTACK

24 июл. 2015 г. - DG OF POLICE. 28. CRLMP 868/ ...... ann.5.Annexure -5 not received.Mc.no. 699/15 at fl.A for further orders on stay.). ..... MC 472/06 at fl.C for.

РКС Компоненты

470 471 472 473 474 475 476 477 478 479 47: 47A 47B 47C 47D 47J 47K 47L ..... ANE ANF ANG ANH ANI ANJ ANK ANL ANM ANN ANO ANP ANQ ANR ANS ..... D-C D-D D-E D-F D-G D-H D-I D-K D-L D-M D-P D-Q D-R D-S D-T D-U D-W ...

The Sun Paper February 20 Page5 - The Sun Paper Newspaper Archive

... churches, schools and fraternal organizations the Snn publishes notices of their ftmd raising ..... 472-78 I Banks FIRST NATIONAL BANK OF McMINNVILLE MCMINNVILLE, OREGON ... d g & Ropairing Fh'estoae "rl es 1109 Lafayette Ave.

Kinematic Formulas for Mean Curvature Powers of ... - jstor

where dg is the normalized kinematic density of G. For example in the case that G is the group of ...... G. Zhang, A sufficient condition for one convex body containing another, Chinese Ann. Math. 9B(4) (1988) ... J. Math. 61 (1939), 461-472. 19.

Topotecan – A Novel Topoisomerase I Inhibitor: Pharmacology and ...

18 янв. 1999 г. - Ann Oncol 1993;4:673–678. ... Ann Oncol 1994;5(suppl 5):191. .... study of topotecan in combination with oral etoposide (abstract 472). .... Swisher EM, Mutch DG, Rader JS, Elbendary A, Herzog TJ: Topotecan in platinum- ...

Кресло dg home george dg f ach473 akv 33 - выбрать и заказать на all-mob.ru

Артикул - DG_48354, Бренд - DG-Home, Серия - Regina, Гарантия, месяцев - 12, Время изготовления, дней - 3, Длина, мм - 1200, Ширина, мм - 400, Высота, мм - 795, ...

Probing QCD (media) with prompt photons - DESY indico

gles) in central Au–Au collisions at √sNN. = 200 GeV measured .... B472 (2000) 175. [10] M. Fontannaz ... CMS, D. G. d'Enterria et al., J. Phys. G34 (2007) 2307.

De rebus suis libri XII

Ann p.837. ... A. | xit ancilla tua Domino meo p.472. .... Vau ufurpatur pro particulâ temporis indicativâ, loco qum» five qando p. 657. A. v. 25. *:> \P' p. 665. D-G.

Skip to main content About Us Contact Us FAQs Language Assistance ...

Po $0FD c&>4 \h-x q#&N J+DG> \D.id @P7lV ckia ---] YM]{}K_] gk3G )SCmK#C ...... jT |WMU-SSpVK 472Sx7 abaZ4 T%GKdm J-}x zTi?i `=gU 4q96 qiG # [P K oG;~ sZ,^ ...... Ep T/rQ )tux 0IW,ID QozyU auT_ (jz} '+Wr cYGx Snn$FY JPls $uAH f.

Женская водолазка DG(695)-SNN - купить в интернет-магазине ...

Женская водолазка DG(695)-SNN, материал гипюровая сетка, страна Турция ... 2223. 2 470. LacyWear. Брюки. 2318. 2 576. LacyWear. Футболка. 561. 623.

Indian Railway Station List with Station Code and Number of Trains ...

5 июн. 2018 г. - 472, Bazpur, BPZ. 473, Beas, BEAS, 54 ..... 1180, Dindigul Junction, DG, 40. 1181, Diphu, DPU ...... 3955, Sonegaon, SNN, 1. 3956, Songadh ...

List of railway stations in India - Wikipedia

List of Indian Railways stations name starting with 'B' alphabet. Station Name Station Code State Railway Zone Elevation Notes Babarpur: BBDE: Haryana

VirtualBox-4.1.30-91550-Linux_x86.run - Oracle VM VirtualBox

< -sU8 |p{k 4I9H yfZ#gwRE -FD] -Dg] 4JA$ DPZS hX8U\ ]/ar GIia 'G8x wO#a 73t]d e 9a dbq9 K(*. ...... GW5P0 4MXDP 8F+l d<L; G;]M@e5 2x#t SnN;o+{ 3$Xc+ %d!! ...... i 5uwX *dy| #(Qz ;472 :!Fg 7`#} '>{H "m2B @|^= =5H@ QDLA sweE JYNc ...

Няшные фото - YouTube

Хехе Я не просила это читать

equivalent dynamic model of distribution network ... - Research Explorer

Dynamic Equivalent Models of Distribution Networks with DG . 23. 1.4 Summary of Past Work . ...... Lately, Artificial Neural Network (ANN) has been used to develop a dynamic equivalent model of power ...... 472-482, 1993. [38] "Standard load ...

Znanstvene publikacije Fizickog odsjeka u 2017. godini

J/ψ Elliptic Flow in Pb-Pb Collisions at √sNN=5.02 TeV. PHYSICAL REVIEW LETTERS. .... at √sNN = 5.02 TeV. PHYSICS LETTERS B. 770, 459-472 (2017).

A100SC_b-29XD.segy - CMGDS

EN{jE _GDSx DNi@DG DnNpD g\C~ 0E'3 FD$dxBq;& ES9]E} L-oC SD}' E|~tET. ...... D.n2D ^EBj#Ed D*}YD472DV ]CGe ~FD7 De@'Dy lDC- ^8bCL D1OjD dNC.

DG 2530 473 Schubert Wanderer Fantasie etc Maurizio Pollini 1974 ...

Maurizio Pollini (piano). Schubert : Wanderer Fantasy / A Minor Sonata. Deutsche Grammophon 2530 473. 1974 Stereo LP. Vinyl excellent / Cover excellent. EXCELLENT (EX) : One or two hairline marks to vinyl, cover has slight wear to edges/creasing etc. | eBay!

Bibliography | Neuronal Dynamics online book

Ann Phys (NY) 173, pp. ..... [115] R. R. de Ruyter van Steveninck, G. D. Lowen, S. P. Strong, R. Koberle and W. Bialek (1997) .... 470–472. Cited by: 20.2. [151] H. M. Fishman, D. J. M. Poussart, L. E. Moore and E. Siebenga (1977) Conduction ...

IAG / AER LINGUS REGULATION - European Commission - Europa EU

14 июл. 2015 г. - Commission européenne, DG COMP MERGER REGISTRY, 1049 ...... (472) IAG's ability to foreclose access to its flights for connecting ...... (DUB, ORK and SNN).429 Its provision of ground handling services to third parties is.

Download - Pfam

... Yeats C;0000-0003-0080-6242 #=GF GA 22.0 22.0 #=GF NC 21.9 21.9 #=GF TC 22.0 22.0 #=GF SE Yeats C #=GF BM hmmbuild HMM.ann SEED.ann #=GF ...

Dg 322 snn в Санкт-Петербурге - mesto-vstrechi.su

Dg 322 snn Dg 322 snn в Санкт-Петербурге. В нашем интернет агрегаторе товаров по Санкт-Петербургу, вы можете выбрать качественный товар по недорогой стоиомсти.

Speakers - 2019 International Trichoscopy Course

... +uzXrn/SnN ..... MytgjvPpppgWcWFfA8v470Ztl79/ xf4CJnNrEPRqewT85kCFLzyzsJnHyxy2Xzu75Q== ...... +2MtiQtKeJaxhYmn8G+ tY93PJwc6rmbkhZ/dg/ ...

Lacywear dg 246 snn, цена - BiaNews

Только тут можно купить lacywear dg 246 snn по цене, которую ты выбираешь сам! Сотни магазинов и миллионы товаров на выбор.

Risposte Attuali del SSN - Ministero della Salute

472. Lombardia. 7. 21. 33. 571. P.A. Bolzano. 3. 3. 1. 272. P.A. Trento. 5. 3. 2. 206 ...... FONTE: Ministero del Lavoro, della Salute e delle Politiche Sociali - DG ...

15 Jan 1923 - Advertising - Trove - National Library of Australia

1st Placo Bookkeeping, D G MoLEOO. Line 0.35.0 .... Name of Deceased Proprietor -Mary Ann. Line 2.24.1 ...... 408 472 Ann street, Brisbane. Line 4.129.0.

MOTORCRAFT DG-473 Ignition, Coil - AutoPartoo.com

buy MOTORCRAFT DG-473, Ignition, Coil DG473 ,find manufacturers of MOTORCRAFT DG-473,Ignition, Coil DG473 for FORD,LINCOLN,MERCURY for price inquiry on autopartoo.com

Быстрая доставка Блузка LacyWear DG(473)-SNN Однотонная ...

Блузка LacyWear DG(473)-SNN Однотонная блузка с короткими.

Dg 575 snn attestacia-abakan.ru

Доставка покупок из интернет магазина attestacia-abakan.ru осуществляется по всей территории России и стран СНГ.

Carriage of dangerous goods- Prohibition Notices - HSE

84, D G McArdle International Ltd, Louth, EU, 06MN2568, IW, 83, 28.1.10, VOSA ...... 58, William Boyce, Kilmarnock, UK, P472 CRM, UL, 57, 16.3.10, VOSA ..... to be taken in ann emergency, nor does he hold a vocational training certificate.

Dg 743 snn lenihlopokshop.ru

Блузка DG(599)-SNN р.48. Женская футболка с принтом. Модель выполнена из мягкого .... 1940 RUR. LacyWear DG(470)-SNN похожие · Подробнее ...

<SEC-DOCUMENT>0001262959-14-000030.txt : 20140918 <SEC ...

+\G^AK_>#X@DG_`.S$D:1<DNM``?/7;&<,O]_^,_XR_)_H"E<+,VF4 MJ,U0I,E\?$F.MM8'S4%:1^.*P5^_O&?\9?D_T'3P2XBNG2C+#[0/\]MQ7Y+L M/KB$_?WC/^ ...

Frontiers | Enhanced HMAX model with feedforward feature learning ...

Field, G. D., Sher, A., Gauthier, J. L., Greschner, M., Shlens, J., Litke, A. M., et al. .... Lowe, D. G. (2004). .... BMCV Workshop (Tübingen: Springer), 472–479.

Chrysanthenum transcriptome database SwissProt blast output of ...

... 452 +R+MADGDAISIFGSSHIWIDHNSLS CADGLVDAVM STAIT+SNN .... 611 FKT+D RGA+VHI+ G C+T+Q++TN+IIHGLHIHDCK GN VR SP HYG+RT++DG Sbjct: .... thaliana GN=At5g15110 PE=2 SV=1 Length = 472 Score = 438 bits (1125), ...

Dani Deahl (@danideahl) | Twitter

The latest Tweets from Dani Deahl (@danideahl). DJ/producer | @recordingacad Governor ... 47 replies 111 retweets 473 likes. Reply. 47. Retweet. 111. Retweeted. 111. Like. 473. Liked. 473. Show this thread ... Undo. Undo. Dani Deahl ...

kood,ngram3,alguskoht doc_100636852915_item,SPV,1 ...

... doc_1010138197_item,ASS,472 doc_1010138197_item,SSS,473 ...... doc_104580264038_item,SDG,30 doc_104580264038_item,DGS,31 ...... doc_104580264061_item,SNN,913 doc_104580264061_item,NNS,914 ...

Amazon.com: Customer reviews: Sigma 150-500mm f/5-6.3 AF APO DG OS HSM ...

Find helpful customer reviews and review ratings for Sigma 150-500mm f/5-6.3 AF APO DG OS HSM Telephoto Zoom Lens for Nikon Digital SLR Cameras at Amazon.com. Read honest and unbiased product reviews from our users.

PHP code - 11 lines - codepad

Output: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 ...

Cp4.1LG05g06780.1 (mRNA) Cucurbita pepo (Zucchini) | Cucurbit ...

Name, Cp4.1LG05g06780.1. Type, mRNA. Organism, Cucurbita pepo (Cucurbita pepo (Zucchini)). Description, Transcriptional corepressor SEUSS. Location ...

Danfoss Power Solutions - Advanced Fluid Systems

346254. SPRING-HELICAL-COMP 6.00x33.30x102.43. 346320. SPR HSG-SERVO,90/055-075 FBA. 346379. RING-RETAINING 34.00x1.50 DIN472. 346387.

GN - Продукция - РКС КОМПОНЕНТЫ

470 471 472 473 474 475 476 477 478 479 47: 47A 47B 47C 47D 47J 47K 47L ..... ANE ANF ANG ANH ANI ANJ ANK ANL ANM ANN ANO ANP ANQ ANR ANS ..... D-C D-D D-E D-F D-G D-H D-I D-K D-L D-M D-P D-Q D-R D-S D-T D-U D-W ...

small RNA-degrading nuclease 1 - Plos

SNN DE+ D D. Sbjct 317 ... +S + ENQRKCSRC KIY VD+DG+ + EEC+YHPLKKRT+RGEQ +LCCKS DD. Sbjct 667 ... 472. Query 1610 ...

Untitled - Nature

mouse 69 GAN QRRDAL GTS CVCLP GY HMI SNN GGP SI ICK ... ES - IK SWYL SRRIFLVDSLS GREK SI S SVPK VIR VA TSI KIRFEL VPDS QE GTV FP 472 ... mouse 486 LTI AY SDI DI KNAH SQ SA KISFSV K Y EMNO GD As VHT DI AL GV ...

Networks of integrate-and-"re neuron using rank order coding A: How ...

This rule has enormous importance in the learning of spiking neural networks (SNN) but its mechanisms and .... Modeling it with a "rst order kinetic of decay time constant. E. , we get. E dg } dt. "#(1!g } ) .... 18 (1998) 10 464}10 472. [2] N. Brunel ...

High-pT Physics in the Heavy Ion Era by Jan Rak

Cambridge Core - Theoretical Physics and Mathematical Physics - High-pT Physics in the Heavy Ion Era - by Jan Rak.

Genetic signatures of human cytomegalovirus variants ... - bioRxiv

2 окт. 2018 г. - 472. Where * = sequence length in amino acids for !,,!5, , = Total number of reads in sample, $534. 473 ... The nearest-neighbor statistic (Snn, distance-based). 484 measures ..... Thompson JD, Gibson TJ, Higgins DG. 2002.

DJ472 - DJ 472 Flight Tracker - FlightStats

DJ472 Flight Tracker - Track the real-time flight status of DJ 472 live using the FlightStats Global Flight Tracker. See if your flight has been delayed or cancelled ...Не найдено: snn(PDF) Rituximab in the spondyloarthropathies: Data of eight patients ...https://www.researchgate.net/.../41166043_Rituximab_in_the... - Перевести эту страницу1 авг. 2018 г. - Scott DG, Bacon PA. .... Ann Rheum Dis February 2010 Vol 69 No 2 471 ... Ann Rheum Dis 2010;69:471–472. doi:10.1136/ard.2008.107102.

References - EMIS

120, Boulware, D. G. and Deser, S., “String Generated Gravity Models”, Phys. Rev. ..... “Observation and studies of jet quenching in PbPb collisions at √sNN--- ...... 472, Kleihaus, B., Kunz, J. and Radu, E., “Black rings in six dimensions”, Phys.

Sonic News Network | FANDOM powered by Wikia

Sonic News Network is a collaborative encyclopedia for everything related to the Sonic the Hedgehog series. It is run by fans for fans of the community that anyone can edit.

@book{gauss1821, author = {C. F. Gauss}, title = {Theoria ...

... Nuno}, journal={Neurocomputing}, volume={50}, pages={461--472}, year={2003}, ...... year = 2011, } @BOOK{Birkhoff:33, author = "G. D. Birkhoff", title = "Aesthetic ...... attention: control, representation, and time course}, journal={Ann. Rev.

Dividend History | NYSE dividend paying stocks

Dividend History | Yields, dates, complete payout history and stock information

CROSS SECTIONS FOR (n, p) REACTIONS ON TIN ... - JETP

(U.S.S.R.) 44, 472-474 (February, 1963). The cross sections .... snn• (n, p) In 119m. 17.5 min. 11.1± ... 3 D. G. Gardner and A. D. Poularikas, Nucl. Phys. 35, 303 ...

San Quintín volcanic field, Baja California, Mexico - Terra Peninsular

472. 41. 41 0. 39 ea ?a7. 69. 41. 41 9. Y. 3 92. 6 7. 5 4. 5 4. 82. *. IM. 237. 8 3. 2 8. B h. I I1 .... from Storey et al., 1989). fb) Snn Borja and Inrapmy Holocene bajaites; dntn from Snunders et al. 11987). .... Drilling Project, 81 (ed. by D.G. Roberts,.

Профессиональная юридическая поддержка бизнеса

Также и по WhatsАpp, Viber 8 (916) 473-57-01. ВРЕМЯ ДЛЯ ПОЛУЧЕНИЯ СКИДКИ ОГРАНИЧЕНО! Более 7 лет успешной работы на ... {snn} {sl} × Заголовок ...

Женская блузка DG(473)-SNN - купить в интернет-магазине ...

Женская блузка DG(473)-SNN, материал вискоза, страна Турция, цена 590.00 руб. Однотонная блузка с короткими рукавами. Модель выполнена из ...

DG473,MOTORCRAFT DG-473 Ignition, Coil - KaKaPart.com

DG473,MOTORCRAFT DG-473 Ignition, Coil from kakapart.com

Two-pion Bose–Einstein correlations in central Pb–Pb collisions at ...

sNN = 2.76 TeV at the Large Hadron Collider is presented. We observe a growing trend with energy now not ..... B 50 (1974) 472. ..... M. Rammler ap, R. Raniwala dg, S. Raniwala dg, S.S. Räsänen af, K.F. Read db, J.S. Real ac, K. Redlich ch,.

Dg 60 bel war-cash.ru

Туника DG(2)-RNK. Туника. 2290 руб. 2544 руб. ... Блузка DG(470)-SNN. Блузка. 1940 руб. 2156 руб. ..... Блузка DG(604)-TOP. Блузка. 2840 руб. 3156 руб.

Measurement of single electrons and implications for charm ...

1 апр. 2002 г. - P. Chung,27 V. Cianciolo,29 B. A. Cole,8 D. G. D'Enterria,34 G. David,3 H. Delagrange,34 A. Denisov,12 .... at √sNN = 130 GeV at the Relativistic Heavy Ion Col- ..... 472 (1976); M. Bourquin and J.-M. Gaillard, Nucl. Phys.

Dg 473 snn udabdikonf.tk

Женская футболка с принтом. Модель выполнена из мягкого трикотажа. Отличный выбор для любого случая. В изделии использованы цвета: белый и ...

Klos - Home | Facebook

Klos. 473 likes. Belgian House DJ Infos & Booking Deejay.kLos@gmail.com Listen www.soundcloud.com/klos Instagram & Twitter: kLos135

S47 snn. Pion Interferometry of (sNN) = 130 GeV Au+Au Collisions at RHIC ...

Pion Interferometry of (sNN) = 130 GeV Au+Au Collisions at RHIC ... K. Turner2 , T. Ullrich2 , D.G. Underwood1 , G. Van Buren2 , A.M. VanderMolen17 , A. Vanyashin15 , I.M. Vasilevski10 , A.N. Vasiliev22 , S.E. Vigdor12 ..... 50B, 472 (1974).

1923 Annual Report - the RNA

attraction Sheep Dog Trials that with our ordinary ring events would easily fill in the ...... Ltd., 468-472 Ann Street. ..... .crawford, D. G., Kilburnie, Laurel Avenue,.

Evolution of the differential transverse momentum ... - DSpace@MIT

22 сент. 2011 г. - Collisions at SNN=200 GeV.” Physics Letters B .... D.G. Underwood t, G. Van Buren g, G. van Nieuwenhuizenh, J.A. Vanfossen Jr. e, R. Varmai,.

SNN Electronic - promodj.com

I have been a DJ since 1983, Mix Master Ace, now i promote digital media from all over the world... I have been promoting,...

DG-Home. Каталог мебели фабрики DG ... - mebhome.ru

Мебельная фабрика DG-Home - о производителе, каталог, цены на мебель DG-Home на сайте MebHOME.Ru. Купить мебель производителя DG-Home (Россия) в Москве.

Settled polynomials over finite fields - American Mathematical Society

11 окт. 2011 г. - is irreducible over K if (−a)dg(fn(γ)) is not a square in K. If K is finite, then we ..... able descendants of snn are the types d1d2d3 with d2d3 = n, i.e. nns, nsn, .... 472. 241. 201. 3. 30. 542. 510. 577. 668. 334. 300. 5. 23. 47. 54. 47.

Dj Baggy Upgraded 473 - Saint George's, Grenada | Facebook

Dj Baggy Upgraded 473, Saint George's, Grenada. 1.9K likes. HI I'M DJ BAGGY AND I LOVE TO ENTERTAIN TO PPL WITH JOKES MUSIC AND ETC.

Тихонов Алексей Александрович – Результаты — Санкт ...

Neutral pion and η meson production in p–Pb collisions at √sNN = 5.02 TeV .... Tikhonov, A. A., Antipov, K. A., Korytnikov, D. G. & Nikitin, D. Y., дек 2017, В : Acta .... 52, 6, стр. 472-480. Результат исследований: Научные публикации в ...

Complet list of 1jgl hssp file

ksddnQqq dh rdaqd gd 93 93 L S S S- 0 0 38 210 76 gaaghakg ...... 375 193 1 sNn 471 393 212 1 sHk 472 43 62 2 qYVl 472 48 69 1 hGw 472 55 77 3 gSGFs ...

32nd Clerks LOG - Guam Legislature

17 июл. 2013 г. - E-mail: rory.forgwzm@gmailcom •Tel: ( 671)472-7 679 • Fax: ( 671 )472-3547. Senator ... FACSIMILE NUMBER: 472-3547 ... \1ichael F.Q. Snn Nicolas ... D.G.. BUILDING !N HAGATNA, IN CONJUNCTION WITH THE GUAM ...

Model Bus Zone - Oxford Die-Cast 1/76 Model List

Model Lists Oxford Die-cast - All 1/76 Scale Models A list of 1/76 scale models compiled by Peter Harrison As at 6 january 2017

Кресло George DG-F-ACH473-sh-18 - vasha-komnata.ru

Интернет-магазин «Ваша комната» предлагает вам купить Кресло George DG-F-ACH473-sh-18 по цене: 72 000 руб Быстрая доставка, низкие цены. Артикул: 20613

Dg News | Сайт О Жизни В Европе, Германии, Новости, Спорт, Бизнес ...

dg-news | November 15, 2016. Берлинские зрители стали свидетелями неповторимого музыкального события. 11 ноября в Адмиралспаласт (Admiralspalast) ...

1 Introduction - SNN Adaptive Intelligence

David Barber. RWCP, Theoretical Foundation SNN, University of Nijmegen, ..... Q(w) fE W + E Dg dw ln ZP ln Z D: (17) ..... Neural Computation 4(3), 448{472.

Блузка LacyWear DG(473)-SNN Однотонная блузка с ~ Блузки ...

10 шт. практике обучения пальцев для ногтевого искусства акриловых ногтей Ложные Советы DIY инструмент UVTL035 Блузка LacyWear DG(473)-SNN ...

Блузка lacywear dg(81)-snn безрукавая блузка с быстрая ...

Безрукавая блузка с отложным воротником. Модель выполнена из приятного материала. Отличный выбор для любого случая.Цвет: черныйРостовка ...

efficiency bar examination for officers in grade iii of public ...

16 февр. 2016 г. - SILVA, L.H.N.T.. 472 PRIYANKARA, P.G.I.K.. 473 PATHMINI, K.K.U. ..... NANDASIRI, D.G.. PRABHADHI, M.H.M. .... SILVA, S.N.N.. LALANI, H.A..

Радиатор irsap tesi 30565 30 25 tea-and-coffeeuk.ru

... quot #nwa5121 ni eu0102f #теплые детские варежки #dg 470 snn #а самарский введение в численные методы #lansung oral hygiene rechargeable #а е ...

Pion Interferometry of (sNN) = 130 GeV Au+Au Collisions at RHIC ...

Pion Interferometry of (sNN) = 130 GeV Au+Au Collisions at RHIC ... K. Turner2 , T. Ullrich2 , D.G. Underwood1 , G. Van Buren2 , A.M. VanderMolen17 , A. Vanyashin15 , I.M. Vasilevski10 , A.N. Vasiliev22 , S.E. Vigdor12 ..... 50B, 472 (1974).

Dg 133 snn ogup-ivces.ru

Блузка DG(599)-SNN р.48. Женская футболка с принтом. Модель выполнена из мягкого трикотажа. Отличный выбор для любого случая. В изделии ...

PDF Form for the submission of complaints concerning alleged unlawful State aid

State aid complaint form - en 3 The amounts of alleged aid, according to Governmental Decision 691/2008, are as follows: - SNN SA loans with Romanian state guarantee (starting with 2012): EUR 220 million

Givt - Nakupujte srdcem | Givt

Nakupujte u těch nejlepších e-shopů a podpořte ty, které máte rádi. U každého e-shopu vidíte počet procent, které ze sumy vašeho nákupu (bez DPH ...

Платье


Гармоничное женское платье из мягкого, вязаного полотна. Обновите свой гардероб качественным изделием!

Цвет: черный.

Ростовка изделия 170 см.

2799 РУБ

LacyWear s-181-snn похожие

Подробнее

Платье


Эффектное платье из вязанного трикотажа. Отличный выбор для повседневного гардероба.

Цвет: серый, черный

Рост девушки-фотомодели 170 см.

2299 РУБ

LacyWear s-19-snn похожие

Подробнее

Платье


Милое платье из хлопкового материала. Отличный выбор для любого случая.

Цвет: белый

Ростовка изделия 170 см

2299 РУБ

LacyWear s-56-snn похожие

Подробнее

Платье


Лаконичное платье с круглой горловиной и рукавами 3/4. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного и делового гардероба.

Цвет: черный

Рост девушки-фотомодели 170 см.

3699 РУБ

LacyWear s-3-snn похожие

Подробнее

Платье


Цветное платье с короткими рукавами. Модель выполнена из эластичного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: черный, серый

Ростовка изделия 170 см.

3399 РУБ

LacyWear s-137-snn похожие

Подробнее

Платье


Красивое платье с квадратной горловиной и короткими рукавами. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного и делового гардероба.

Цвет: черный, белый

Ростовка изделия 170 см.

2699 РУБ

LacyWear s-33-snn похожие

Подробнее

Платье


Цветное платье с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для любого случая.

Цвет: бежевый, белый, коричневый

Рост девушки-фотомодели 170 см.

2540 РУБ

LacyWear s-97-snn похожие

Подробнее

Платье


Замечательное платье без рукавов. Модель выполнена из приятного материала с отделкой из ажурного гипюра. Отличный выбор для любого случая.

Цвет: красный, молочный

Ростовка изделия 170 см

1899 РУБ

LacyWear s-83-snn похожие

Подробнее

Платье


Уютное платье с короткими рукавами из вязаного трикотажа. Вязаный трикотаж - это красота, тепло и комфорт. В вязанных вещах очень легко оставаться женственной и в то же время не замёрзнуть.

В изделии использованы цвета: серый

Рост девушки-фотомодели 170 см

1799 РУБ

LacyWear s-128-snn похожие

Подробнее

Платье


Красивое платье без рукавов. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

Цвет: зеленый, голубой, белый, розовый

Рост девушки-фотомодели 170 см.

2299 РУБ

LacyWear s-105-snn похожие

Подробнее

Платье


Летнее платье на тонких бретелях. Модель выполнена из приятного материала. Отличный выбор для любого случая.

В изделии использованы цвета: синий

Рост девушки-фотомодели 170 см

1299 РУБ

LacyWear s-167-snn похожие

Подробнее

Комментарии



Подпишитесь на новые товары в chain-hook.ru